PDB entry 1ba7

View 1ba7 on RCSB PDB site
Description: soybean trypsin inhibitor
Class: serine protease inhibitor
Keywords: serine protease inhibitor, trypsin inhibitor (kunitz)
Deposited on 1998-04-22, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.16
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypsin inhibitor (kunitz)
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ba7a_
  • Chain 'B':
    Compound: trypsin inhibitor (kunitz)
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ba7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ba7A (A:)
    dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
    pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
    ervsddefnnyklvfcpqqaeddkcgdigisidhddgtrrlvvsknkplvvqfqkldkes
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ba7A (A:)
    dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
    pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
    ervnnyklvfcpqcgdigisidhddgtrrlvvsknkplvvqfqkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ba7B (B:)
    dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
    pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
    ervsddefnnyklvfcpqqaeddkcgdigisidhddgtrrlvvsknkplvvqfqkldkes
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ba7B (B:)
    dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
    pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
    ervsfnnyklvfcpqdkcgdigisidhddgtrrlvvsknkplvvqfqkl