PDB entry 1ba6

View 1ba6 on RCSB PDB site
Description: solution structure of the methionine-oxidized amyloid beta-peptide (1-40). does oxidation affect conformational switching? nmr, 10 structures
Deposited on 1998-04-22, released 1998-06-17
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid beta-peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05067 (0-39)
      • modified residue (34)

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1ba6A (A:)
    daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvv