PDB entry 1ba5

View 1ba5 on RCSB PDB site
Description: dna-binding domain of human telomeric protein, htrf1, nmr, 18 structures
Deposited on 1998-04-22, released 1999-04-27
The last revision prior to the SCOP 1.71 freeze date was dated 1999-04-27, with a file datestamp of 1999-04-26.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1ba5__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ba5_ (-)
    rkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl