PDB entry 1ba5

View 1ba5 on RCSB PDB site
Description: DNA-binding domain of human telomeric protein, htrf1, nmr, 18 structures
Class: DNA-binding domain
Keywords: DNA-binding domain, myb repeats, nmr, telomeres, trf
Deposited on 1998-04-22, released 1999-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: htrf1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ba5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ba5A (A:)
    rkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl