PDB entry 1ba4

View 1ba4 on RCSB PDB site
Description: the solution structure of amyloid beta-peptide (1-40) in a water-micelle environment. is the membrane-spanning domain where we think it is? nmr, 10 structures
Deposited on 1998-04-07, released 1998-06-17
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid beta-peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1ba4A (A:)
    daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvv