PDB entry 1ba4

View 1ba4 on RCSB PDB site
Description: the solution structure of amyloid beta-peptide (1-40) in a water-micelle environment. is the membrane-spanning domain where we think it is? nmr, 10 structures
Class: glycoprotein
Keywords: glycoprotein, amyloid beta-peptide, alzheimer's disease, sds-micelles
Deposited on 1998-04-07, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: amyloid beta-peptide
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05067 (0-39)
  Domains in SCOPe 2.08: d1ba4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ba4A (A:)
  daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvv