PDB entry 1ba2

View 1ba2 on RCSB PDB site
Description: d67r mutant of d-ribose-binding protein from escherichia coli
Class: transport
Keywords: transport, chemotaxis, periplasm
Deposited on 1998-04-19, released 1998-07-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-ribose-binding protein
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02925 (0-270)
      • engineered (66)
    Domains in SCOPe 2.02: d1ba2a_
  • Chain 'B':
    Compound: d-ribose-binding protein
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02925 (0-270)
      • engineered (66)
    Domains in SCOPe 2.02: d1ba2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ba2A (A:)
    kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
    llinptrsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
    gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
    pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
    gakgvetadkvlkgekvqakypvdlklvvkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ba2B (B:)
    kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
    llinptrsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
    gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
    pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
    gakgvetadkvlkgekvqakypvdlklvvkq