PDB entry 1b9z

View 1b9z on RCSB PDB site
Description: bacillus cereus beta-amylase complexed with maltose
Class: hydrolase
Keywords: hydrolase(o-glycosyl)
Deposited on 1999-03-06, released 1999-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.17
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (beta-amylase)
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b9za1, d1b9za2
  • Heterogens: MAL, ACT, SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9zA (A:)
    avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
    qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
    etgtvnketlnplasdvirkeygelytafaaamkpykdviakiylsggpagelrypsytt
    sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
    lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
    phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
    givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgvtpv
    mqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaernie
    fkafikskdgtvkswqtiqqswnpvplkttshtssw