PDB entry 1b9w

View 1b9w on RCSB PDB site
Description: c-terminal merozoite surface protein 1 from plasmodium cynomolgi
Deposited on 1999-02-15, released 1999-05-24
The last revision prior to the SCOP 1.59 freeze date was dated 1999-08-18, with a file datestamp of 1999-08-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9wA (A:)
    mssehrcidtnvpenaacyryldgteewrcllyfkedagkcvpapnmtckdknggcapea
    eckmndkneivckctkegseplfegvfcs