PDB entry 1b9v

View 1b9v on RCSB PDB site
Description: novel aromatic inhibitors of influenza virus neuraminidase make selective interactions with conserved residues and water molecules in teh active site
Deposited on 1999-02-15, released 1999-02-27
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-01, with a file datestamp of 2000-05-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.183
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b9va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9vA (A:)
    epewtyprlscqgstfqkallisphrfgeikgnsapliirepfvacgpkecrhfalthya
    aqpggyyngtrkdrnklrhlvsvklgkiptvensifhmaawsgsachdgrewtyigvdgp
    dndalvkikygeaytdtyhsyahnilrtqesacnciggdcylmitdgsasgiskcrflki
    regriikeilptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctktyldtprpddgsiagpcesngdkwlggikggfvhqrmaskigrwysrtmsktnrmg
    melyvrydgdpwtdsdaltlsgvmvsieepgwysfgfeikdkkcdvpcigiemvhdggkd
    twhsaataiyclmgsgqllwdtvtgvdmal