PDB entry 1b9v

View 1b9v on RCSB PDB site
Description: novel aromatic inhibitors of influenza virus neuraminidase make selective interactions with conserved residues and water molecules in teh active site
Class: hydrolase
Keywords: influenza, neuraminidase, sialidase, b/lee/40, hydrolase
Deposited on 1999-02-15, released 1999-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.183
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (neuraminidase)
    Species: Influenza B virus (B/Lee/40) [TaxId:107412]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b9va_
  • Heterogens: NAG, CA, RA2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9vA (A:)
    epewtyprlscqgstfqkallisphrfgeikgnsapliirepfvacgpkecrhfalthya
    aqpggyyngtrkdrnklrhlvsvklgkiptvensifhmaawsgsachdgrewtyigvdgp
    dndalvkikygeaytdtyhsyahnilrtqesacnciggdcylmitdgsasgiskcrflki
    regriikeilptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctktyldtprpddgsiagpcesngdkwlggikggfvhqrmaskigrwysrtmsktnrmg
    melyvrydgdpwtdsdaltlsgvmvsieepgwysfgfeikdkkcdvpcigiemvhdggkd
    twhsaataiyclmgsgqllwdtvtgvdmal