PDB entry 1b9o

View 1b9o on RCSB PDB site
Description: human alpha-lactalbumin, low temperature form
Class: calcium-binding protein
Keywords: calcium-binding protein, high resolution
Deposited on 1999-02-14, released 1999-03-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.119
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (alpha-lactalbumin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1b9oa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9oA (A:)
    kqftkcelsqllkdidgyggialpelictmfhtsgydtqaivendesteyglfqisnklw
    ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc
    ekl