PDB entry 1b9o

View 1b9o on RCSB PDB site
Description: human alpha-lactalbumin, low temperature form
Deposited on 1999-02-14, released 1999-03-31
The last revision prior to the SCOP 1.65 freeze date was dated 1999-03-31, with a file datestamp of 1999-04-06.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.119
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1b9oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9oA (A:)
    kqftkcelsqllkdidgyggialpelictmfhtsgydtqaivendesteyglfqisnklw
    ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc
    ekl