PDB entry 1b9m

View 1b9m on RCSB PDB site
Description: regulator from escherichia coli
Class: transcription
Keywords: DNA-binding, gene regulation, winged helix turn helix, molybdate, ob fold, transcription
Deposited on 1999-02-12, released 2000-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.234
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (mode)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9G8 (3-264)
      • see remark 999 (2)
      • modified residue (3)
      • modified residue (57)
      • modified residue (223)
    Domains in SCOPe 2.07: d1b9ma1, d1b9ma3, d1b9ma4
  • Chain 'B':
    Compound: protein (mode)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9G8 (3-264)
      • see remark 999 (2)
      • modified residue (3)
      • modified residue (57)
      • modified residue (223)
    Domains in SCOPe 2.07: d1b9mb1, d1b9mb3, d1b9mb4
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b9mA (A:)
    gshmqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnq
    lsehilveratggkggggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaa
    isrfslqtsarnqwfgtitardhddvqqhvdvlladgktrlkvaitaqsgarlgldegke
    vlillkapwvgitqdeavaqnadnqlpgiishiergaeqcevlmalpdgqtlcatvpvne
    atslqqgqnvtayfnadsviiatlc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9mA (A:)
    hmqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqls
    ehilveratggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisrfslq
    tsarnqwfgtitardhddvqqhvdvlladgktrlkvaitaqsgarlgldegkevlillka
    pwvgitqdeavaqnadnqlpgiishiergaeqcevlmalpdgqtlcatvpvneatslqqg
    qnvtayfnadsviiatlc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b9mB (B:)
    gshmqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnq
    lsehilveratggkggggavltrygqrliqlydllaqiqqkafdvlsdddalplnsllaa
    isrfslqtsarnqwfgtitardhddvqqhvdvlladgktrlkvaitaqsgarlgldegke
    vlillkapwvgitqdeavaqnadnqlpgiishiergaeqcevlmalpdgqtlcatvpvne
    atslqqgqnvtayfnadsviiatlc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9mB (B:)
    hmqaeilltlklqqklfadprrisllkhialsgsisqgakdagisyksawdainemnqls
    ehilveravltrygqrliqlydllaqiqqkafdvlsdddalplnsllaaisrfslqtsar
    nqwfgtitaqhvdvlladgktrlkvaitaqsgarlgldegkevlillkapwvgitqdeav
    aqnadnqlpgiishiergaeqcevlmalpdgqtlcatvpvneatslqqgqnvtayfnads
    viiatlc