PDB entry 1b9l

View 1b9l on RCSB PDB site
Description: 7,8-dihydroneopterin triphosphate epimerase
Class: isomerase
Keywords: epimerase, isomerase
Deposited on 1999-02-11, released 2000-02-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.188
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (epimerase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b9la_
  • Chain 'B':
    Compound: protein (epimerase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b9lb_
  • Chain 'C':
    Compound: protein (epimerase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b9lc_
  • Chain 'D':
    Compound: protein (epimerase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b9ld_
  • Chain 'E':
    Compound: protein (epimerase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b9le_
  • Chain 'F':
    Compound: protein (epimerase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b9lf_
  • Chain 'G':
    Compound: protein (epimerase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b9lg_
  • Chain 'H':
    Compound: protein (epimerase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b9lh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b9lA (A:)
    maqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtv
    tkniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9lA (A:)
    aqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtvt
    kniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b9lB (B:)
    maqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtv
    tkniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9lB (B:)
    aqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtvt
    kniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b9lC (C:)
    maqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtv
    tkniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9lC (C:)
    aqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtvt
    kniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b9lD (D:)
    maqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtv
    tkniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9lD (D:)
    aqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtvt
    kniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1b9lE (E:)
    maqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtv
    tkniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9lE (E:)
    aqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtvt
    kniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1b9lF (F:)
    maqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtv
    tkniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9lF (F:)
    aqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtvt
    kniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1b9lG (G:)
    maqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtv
    tkniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9lG (G:)
    aqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtvt
    kniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1b9lH (H:)
    maqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtv
    tkniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9lH (H:)
    aqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtvt
    kniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr