PDB entry 1b9k

View 1b9k on RCSB PDB site
Description: alpha-adaptin appendage domain, from clathrin adaptor ap2
Deposited on 1999-02-11, released 1999-07-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-09, with a file datestamp of 2000-06-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.172
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9kA (A:)
    ednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqflnftptlicadd
    lqtnlnlqtkpvdptvdggaqvqqviniecisdfteapvlniqfryggtfqnvsvklpit
    lnkffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleevd
    pnpanfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf