PDB entry 1b9g

View 1b9g on RCSB PDB site
Description: insulin-like-growth-factor-1
Class: growth factor
Keywords: growth factor igf-1
Deposited on 1999-02-11, released 1999-02-23
The last revision prior to the SCOP 1.75 freeze date was dated 1999-02-23, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (growth factor igf-1)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1b9ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9gA (A:)
    gpetlcgaelvdalqfvcgdrgfyfnkpgivdeccfrscdlrrlemycaplkpaksa