PDB entry 1b9e

View 1b9e on RCSB PDB site
Description: human insulin mutant serb9glu
Class: hormone/growth factor
Keywords: hormone, fast-acting insulin, hormone/growth factor complex
Deposited on 1998-11-12, released 1999-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.165
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (insulin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b9e.1
  • Chain 'B':
    Compound: protein (insulin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-29)
      • engineered (8)
    Domains in SCOPe 2.07: d1b9e.1
  • Chain 'C':
    Compound: protein (insulin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b9e.2
  • Chain 'D':
    Compound: protein (insulin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-29)
      • engineered (8)
    Domains in SCOPe 2.07: d1b9e.2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9eA (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9eB (B:)
    fvnqhlcgehlvealylvcgergffytpkt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9eC (C:)
    giveqcctsicslyqlenycn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9eD (D:)
    fvnqhlcgehlvealylvcgergffytpkt