PDB entry 1b9e

View 1b9e on RCSB PDB site
Description: human insulin mutant serb9glu
Class: hormone/growth factor
Keywords: hormone, fast-acting insulin, hormone/growth factor complex
Deposited on 1998-11-12, released 1999-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.165
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (insulin)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1b9e.1
• Chain 'B':
  Compound: protein (insulin)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered (8)
  Domains in SCOPe 2.08: d1b9e.1
• Chain 'C':
  Compound: protein (insulin)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
  Domains in SCOPe 2.08: d1b9e.2
• Chain 'D':
  Compound: protein (insulin)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-29)
    • engineered (8)
  Domains in SCOPe 2.08: d1b9e.2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b9eA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b9eB (B:)
  fvnqhlcgehlvealylvcgergffytpkt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b9eC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b9eD (D:)
  fvnqhlcgehlvealylvcgergffytpkt