PDB entry 1b9d

View 1b9d on RCSB PDB site
Description: mobility of an hiv-1 integrase active site loop is correlated with catalytic activity
Class: transferase
Keywords: DNA integration, transferase
Deposited on 1999-02-11, released 1999-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (integrase)
    Species: Human immunodeficiency virus [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497
      • engineered mutation (135)
    Domains in SCOPe 2.08: d1b9da_
  • Heterogens: CAC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b9dA (A:)
    mhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwp
    vktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqa
    ehlktavqmavfihnkkrkggiggysagerivdiiatdiqtke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9dA (A:)
    spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
    ngsnftsttvkaacwwagikqefggviesmnkelkkiigqvrdqaehlktavqmavfihn
    kkrkggysagerivdiiatdiqt