PDB entry 1b9c

View 1b9c on RCSB PDB site
Description: Green Fluorescent Protein Mutant F99S, M153T and V163A
Class: luminescent protein
Keywords: fluorescent protein, chromophore, green fluorescent protein, luminescence, f99s m153t v163a mutant, luminescent protein
Deposited on 1999-02-09, released 2000-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.204
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (green fluorescent protein)
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • chromophore (65)
      • mutation (98)
      • mutation (152)
      • mutation (162)
    Domains in SCOPe 2.07: d1b9ca_
  • Chain 'B':
    Compound: protein (green fluorescent protein)
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • chromophore (65)
      • mutation (98)
      • mutation (152)
      • mutation (162)
    Domains in SCOPe 2.07: d1b9cb_
  • Chain 'C':
    Compound: protein (green fluorescent protein)
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • chromophore (65)
      • mutation (98)
      • mutation (152)
      • mutation (162)
    Domains in SCOPe 2.07: d1b9cc_
  • Chain 'D':
    Compound: protein (green fluorescent protein)
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • chromophore (65)
      • mutation (98)
      • mutation (152)
      • mutation (162)
    Domains in SCOPe 2.07: d1b9cd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b9cA (A:)
    askgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfgygvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9cA (A:)
    geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
    fgygvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvnri
    elkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhyq
    qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b9cB (B:)
    askgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfgygvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9cB (B:)
    geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
    fgygvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvnri
    elkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhyq
    qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b9cC (C:)
    askgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfgygvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9cC (C:)
    geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
    fgygvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvnri
    elkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhyq
    qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b9cD (D:)
    askgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfgygvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9cD (D:)
    geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
    fgygvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvnri
    elkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhyq
    qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit