PDB entry 1b9b

View 1b9b on RCSB PDB site
Description: triosephosphate isomerase of thermotoga maritima
Class: isomerase
Keywords: isomerase, thermophilic, thermotoga maritima
Deposited on 1999-02-09, released 2000-01-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.211
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (triosephosphate isomerase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b9ba_
  • Chain 'B':
    Compound: protein (triosephosphate isomerase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b9bb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b9bA (A:)
    itrklilagnwkmhktiseakkfvsllvnelhdvkefeivvcppftalsevgeilsgrni
    klgaqnvfyedqgaftgeisplmlqeigveyvivghserrrifkeddefinrkvkavlek
    gmtpilcvgetleerekgltfcvvekqvregfygldkeeakrvviayepvwaigtgrvat
    pqqaqevhafirkllsemydeetagsirilyggsikpdnflglivqkdidgglvggaslk
    esfielarimrgvis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9bA (A:)
    trklilagnwkmhktiseakkfvsllvnelhdvkefeivvcppftalsevgeilsgrnik
    lgaqnvfyedqgaftgeisplmlqeigveyvivghserrrifkeddefinrkvkavlekg
    mtpilcvgetleerekgltfcvvekqvregfygldkeeakrvviayepvwaigtgrvatp
    qqaqevhafirkllsemydeetagsirilyggsikpdnflglivqkdidgglvggaslke
    sfielarimrgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9bB (B:)
    itrklilagnwkmhktiseakkfvsllvnelhdvkefeivvcppftalsevgeilsgrni
    klgaqnvfyedqgaftgeisplmlqeigveyvivghserrrifkeddefinrkvkavlek
    gmtpilcvgetleerekgltfcvvekqvregfygldkeeakrvviayepvwaigtgrvat
    pqqaqevhafirkllsemydeetagsirilyggsikpdnflglivqkdidgglvggaslk
    esfielarimrgvis