PDB entry 1b98

View 1b98 on RCSB PDB site
Description: neurotrophin 4 (homodimer)
Class: hormone/growth factor
Keywords: target-derived survival factor, neurotrophin 4, neurotrophin 5, hormone/growth factor complex
Deposited on 1999-02-22, released 1999-02-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.235
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (neurotrophin-4)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1b98a_
  • Chain 'M':
    Compound: protein (neurotrophin-4)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1b98m_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b98A (A:)
    gvsetapasrrgelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetr
    ckadnaeeggpgaggggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacv
    ctllsrtgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b98A (A:)
    elavcdavsgwvtdrrtavdlrgrevevlgevlrqyffetrckadnaeeggpgaggggcr
    gvdrrhwvseckakqsyvraltavgwrwiridtacvctllsrt
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1b98M (M:)
    gvsetapasrrgelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetr
    ckadnaeeggpgaggggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacv
    ctllsrtgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b98M (M:)
    rgelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetrckadeggpga
    ggggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacvctllsr