PDB entry 1b98

View 1b98 on RCSB PDB site
Description: neurotrophin 4 (homodimer)
Deposited on 1999-02-22, released 1999-02-26
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-07, with a file datestamp of 2000-01-06.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.235
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b98a_
  • Chain 'M':
    Domains in SCOP 1.55: d1b98m_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b98A (A:)
    elavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetrckadnaeeggpg
    aggggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacvctllsrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b98A (A:)
    elavcdavsgwvtdrrtavdlrgrevevlgevlrqyffetrckadnaeeggpgaggggcr
    gvdrrhwvseckakqsyvraltavgwrwiridtacvctllsrt
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1b98M (M:)
    rgelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetrckadnaeegg
    pgaggggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacvctllsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b98M (M:)
    rgelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetrckadeggpga
    ggggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacvctllsr