PDB entry 1b8z

View 1b8z on RCSB PDB site
Description: hu from thermotoga maritima
Class: DNA binding protein
Keywords: thermotoga maritima, thermostable DNA binding protein
Deposited on 1999-02-03, released 2000-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.215
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (histonelike protein hu)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b8za_
  • Chain 'B':
    Compound: protein (histonelike protein hu)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b8zb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b8zA (A:)
    mnkkelidrvakkagakkkdvklildtiletitealakgekvqivgfgsfevrkaaarkg
    vnpqtrkpitiperkvpkfkpgkalkekvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b8zA (A:)
    mnkkelidrvakkagakkkdvklildtiletitealakgekvqivgfgsfevvpkfkpgk
    alkekvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b8zB (B:)
    mnkkelidrvakkagakkkdvklildtiletitealakgekvqivgfgsfevrkaaarkg
    vnpqtrkpitiperkvpkfkpgkalkekvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b8zB (B:)
    mnkkelidrvakkagakkkdvklildtiletitealakgekvqivgfgsfevvpkfkpgk
    alkekvk