PDB entry 1b8y

View 1b8y on RCSB PDB site
Description: x-ray structure of human stromelysin catalytic domain complexed with non-peptide inhibitors: implications for inhibitor selectivity
Deposited on 1999-02-03, released 1999-08-31
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-31, with a file datestamp of 1999-08-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b8ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8yA (A:)
    frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
    misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
    ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpp