PDB entry 1b8x

View 1b8x on RCSB PDB site
Description: glutathione s-transferase fused with the nuclear matrix targeting signal of the transcription factor aml-1
Class: signal protein
Keywords: nuclear matrix targeting signal protein, signal protein
Deposited on 1999-02-03, released 1999-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.209
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (aml-1b)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b8xa1, d1b8xa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b8xA (A:)
    spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
    dvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkvd
    flsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkk
    rieaipqidkylksskyiawplqgwqatfgggdhppksdlvprgsrrasvgsrmhypgaf
    tysptpvtsgigigmsamgsatryhtylpppypgefivid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b8xA (A:)
    spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
    dvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkvd
    flsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkk
    rieaipqidkylksskyiawplqgwqatfgggdhppksdlvprgsrrasvgsrmhypgaf
    tysptpvtsgigigmsamgs