PDB entry 1b8w

View 1b8w on RCSB PDB site
Description: defensin-like peptide 1
Class: toxin
Keywords: toxin, platypus
Deposited on 1999-02-02, released 1999-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (defensin-like peptide 1)
    Species: Ornithorhynchus anatinus [TaxId:9258]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b8wa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8wA (A:)
    fvqhrprdcesingvcrhkdtvncreifladcyndgqkccrk