SCOPe 2.07: Structural Classification of Proteins

PDB entry 1b8t

View 1b8t on RCSB PDB site
Description: solution structure of the chicken crp1
Class: contractile
Keywords: lim domain, crp, nmr, muscle differentiation, contractile
Deposited on 1999-02-02, released 1999-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: protein (crp1)
Species: Gallus gallus [TaxId:9031]
Database cross-references and differences (RAF-indexed):
- Uniprot P67966 (0-191)
Domains in SCOPe 2.07: d1b8ta1, d1b8ta2, d1b8ta3, d1b8ta4
Heterogens: ZN

PDB Chain Sequences:

Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)

>1b8tA (A:)
mpnwgggkkcgvcqkavyfaeevqcegssfhkscflcmvckknldsttvavhgdeiycks
cygkkygpkgkgkgmgagtlstdkgeslgikyeegqshrptnpnasrmaqkvggsdgcpr
cgqavyaaekvigagkswhkscfrcakcgkslesttladkdgeiyckgcyaknfgpkgfg
fgqgagalihsq