PDB entry 1b8t

View 1b8t on RCSB PDB site
Description: solution structure of the chicken crp1
Class: contractile
Keywords: lim domain, crp, nmr, muscle differentiation, contractile
Deposited on 1999-02-02, released 1999-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8tA (A:)
    mpnwgggkkcgvcqkavyfaeevqcegssfhkscflcmvckknldsttvavhgdeiycks
    cygkkygpkgkgkgmgagtlstdkgeslgikyeegqshrptnpnasrmaqkvggsdgcpr
    cgqavyaaekvigagkswhkscfrcakcgkslesttladkdgeiyckgcyaknfgpkgfg
    fgqgagalihsq