PDB entry 1b8s

View 1b8s on RCSB PDB site
Description: cholesterol oxidase from streptomyces glu361gln mutant
Class: flavoenzyme
Keywords: flavoenzyme, steroid metabolism, oxidoreductase
Deposited on 1999-02-02, released 1999-02-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cholesterol oxidase)
    Species: Streptomyces sp. [TaxId:1931]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12676 (3-493)
      • see remark 999 (435)
    Domains in SCOPe 2.08: d1b8sa1, d1b8sa2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b8sA (A:)
    dnggyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkrs
    swfknrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmave
    pkrsyfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagkag
    lgtvfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvtiq
    tlhqvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardtg
    tlpnlnsevgagwgpngnimtaranhmwnptgahqssipalgidawdnsdssvfaqiapm
    pagletwvslylaitknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkang
    tiyrydlfgtqlkafaddfcyhplggcvlgkatddygrvagyknlyvtdgslipgsvgvn
    pfvtitalaernveriikqdvtas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b8sA (A:)
    gyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkrsswf
    knrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmavepkr
    syfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagkaglgt
    vfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvtiqtlh
    qvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardtgtlp
    nlnsevgagwgpngnimtaranhmwnptgahqssipalgidawdnsdssvfaqiapmpag
    letwvslylaitknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiy
    rydlfgtqlkafaddfcyhplggcvlgkatddygrvagyknlyvtdgslipgsvgvnpfv
    titalaernveriikqdv