PDB entry 1b8q

View 1b8q on RCSB PDB site
Description: solution structure of the extended neuronal nitric oxide synthase pdz domain complexed with an associated peptide
Class: oxidoreductase
Keywords: pdz domain, nnos, nitric oxide synthase, oxidoreductase
Deposited on 1999-02-01, released 1999-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (neuronal nitric oxide synthase)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29476 (0-126)
      • conflict (1-3)
      • conflict (5)
    Domains in SCOPe 2.08: d1b8qa_
  • Chain 'B':
    Compound: protein (heptapeptide)
    Database cross-references and differences (RAF-indexed):
    • PDB 1B8Q (0-6)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8qA (A:)
    gshmiepnvisvrlfkrkvgglgflvkervskppviisdlirggaaeqsgliqagdiila
    vndrplvdlsydsalevlrgiasethvvlilrgpegftthlettftgdgtpktirvtqpl
    gpptkav
    

  • Chain 'B':
    No sequence available.