PDB entry 1b8o

View 1b8o on RCSB PDB site
Description: purine nucleoside phosphorylase
Deposited on 1999-02-02, released 1999-02-08
The last revision prior to the SCOP 1.67 freeze date was dated 2001-04-27, with a file datestamp of 2001-04-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.184
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1b8oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b8oA (A:)
    mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdyesqgkanheevleagkqaaqkleqfvsllmasipv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b8oA (A:)
    ngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestvp
    ghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnp
    nfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkqmg
    eqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslit
    nkvimdyesqgkanheevleagkqaaqkleqfvsllmasi