PDB entry 1b8m

View 1b8m on RCSB PDB site
Description: brain derived neurotrophic factor, neurotrophin-4
Class: growth factor/neurotrophin-4
Keywords: complex (growth factor/growth factor), neurotrophin
Deposited on 1999-02-01, released 1999-02-09
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.198
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (brain derived neurotrophic factor)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • GB HUMBDNFB
    Domains in SCOP 1.73: d1b8ma_
  • Chain 'B':
    Compound: protein (neurotrophin-4)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • GB HUMPPNT4P (Start-129)
    Domains in SCOP 1.73: d1b8mb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b8mA (A:)
    hsdparrgelsvcdsisewvtaadkktavdmsggtvtvlekvpvskgqlkqyfyetkcnp
    mgytkegcrgidkrhwnsqcrttqsyvraltmdskkrigwrfiridtscvctltikrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b8mA (A:)
    gelsvcdsisewvtaadkktavdmsggtvtvlekvpvskgqlkqyfyetkcnpmgytkeg
    crgidkrhwnsqcrttqsyvraltmdskkrigwrfiridtscvctltik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b8mB (B:)
    gvsetapasrrgelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetr
    ckadnaeeggpgaggggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacv
    ctllsrtgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b8mB (B:)
    gelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetrckaaggpgagg
    ggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacvctllsrtgra