PDB entry 1b8m

View 1b8m on RCSB PDB site
Description: brain derived neurotrophic factor, neurotrophin-4
Deposited on 1999-02-01, released 1999-02-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-12, with a file datestamp of 2000-01-11.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.198
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b8ma_
  • Chain 'B':
    Domains in SCOP 1.55: d1b8mb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8mA (A:)
    gelsvcdsisewvtaadkktavdmsggtvtvlekvpvskgqlkqyfyetkcnpmgytkeg
    crgidkrhwnsqcrttqsyvraltmdskkrigwrfiridtscvctltik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b8mB (B:)
    gelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetrckadnaeeggp
    gaggggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacvctllsrtgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b8mB (B:)
    gelavcdavsgwvtdrrtavdlrgrevevlgevpaaggsplrqyffetrckaaggpgagg
    ggcrgvdrrhwvseckakqsyvraltadaqgrvgwrwiridtacvctllsrtgra