PDB entry 1b8l

View 1b8l on RCSB PDB site
Description: Calcium-bound D51A/E101D/F102W Triple Mutant of Beta Carp Parvalbumin
Class: calcium binding protein
Keywords: calcium binding protein, ef-hand proteins, parvalbumin, calcium-binding
Deposited on 1999-02-01, released 1999-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (parvalbumin)
  Species: Cyprinus carpio [TaxId:7962]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02618 (0-107)
  Domains in SCOPe 2.08: d1b8la_
• Heterogens: CO3, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b8lA (A:)
  afagvlndadiaaaleackaadsfnhkaffakvgltsksaddvkkafaiiaqdksgfiee
  delklflqnfkadaraltdgetktflkagdsdgdgkigvddwtalvka