PDB entry 1b8k

View 1b8k on RCSB PDB site
Description: Neurotrophin-3 from Human
Deposited on 1999-02-01, released 1999-02-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-15, with a file datestamp of 2000-09-15.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.238
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b8ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b8kA (A:)
    ysvcdseslwvtdkssaidirghqvtvlgeiktgnspvkqyfyetrckearpvkngcrgi
    ddkhwnsqcktsqtyvraltsennklvgwrwiridtscvcal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b8kA (A:)
    ysvcdseslwvtdkssaidirghqvtvlgeivkqyfyetrckegcrgiddkhwnsqckts
    qtyvraltsennklvgwrwiridtscvcal