PDB entry 1b8j

View 1b8j on RCSB PDB site
Description: alkaline phosphatase complexed with vanadate
Class: alkaline phosphatase
Keywords: alkaline phosphatase, hydrolase, phosphoric monoester, transferase (phospho, alcohol acceptor), vanadate
Deposited on 1999-02-01, released 1999-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (alkaline phosphatase)
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (0-448)
      • modified residue (101)
    Domains in SCOPe 2.07: d1b8ja_
  • Chain 'B':
    Compound: protein (alkaline phosphatase)
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (0-448)
      • modified residue (101)
    Domains in SCOPe 2.07: d1b8jb_
  • Heterogens: ZN, SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8jA (A:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8jB (B:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk