PDB entry 1b8i

View 1b8i on RCSB PDB site
Description: structure of the homeotic ubx/exd/dna ternary complex
Deposited on 1999-02-01, released 1999-04-12
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-22, with a file datestamp of 2000-05-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.224
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b8ia_
  • Chain 'B':
    Domains in SCOP 1.55: d1b8ib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1b8iA (A:)
fypwmaiagtnglrrrgrqtytryqtlelekefhtnhyltrrrriemahalslterqiki
wfqnrrmklkkei

    Sequence, based on observed residues (ATOM records): (download) 
    >1b8iA (A:)
fypwmarqtytryqtlelekefhtnhyltrrrriemahalslterqikiwfqnrrmklkk
ei

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b8iB (B:)
rrnfskqaseilneyfyshlsnpypseeakeelarkcgitvsqvsnwfgnkrirykkn