PDB entry 1b8i

View 1b8i on RCSB PDB site
Description: structure of the homeotic ubx/exd/DNA ternary complex
Class: transcription/DNA
Keywords: DNA binding, homeodomain, homeotic proteins, development, specificity, transcription/DNA complex
Deposited on 1999-02-01, released 1999-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.224
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ultrabithorax homeotic protein IV)
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: UBX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83949
      • engineered (57)
    Domains in SCOPe 2.08: d1b8ia_
  • Chain 'B':
    Compound: protein (homeobox protein extradenticle)
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b8ib_
  • Chain 'C':
    Compound: DNA (5'-d(*gp*tp*cp*gp*cp*cp*ap*tp*ap*ap*ap*tp*cp*ap*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*cp*gp*tp*gp*ap*tp*tp*tp*ap*tp*gp*gp*cp*g)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1b8iA (A:)
qasnhtfypwmaiagtnglrrrgrqtytryqtlelekefhtnhyltrrrriemahalslt
erqikiwfqnrrmklkkeiqa

    Sequence, based on observed residues (ATOM records): (download) 
    >1b8iA (A:)
fypwmarqtytryqtlelekefhtnhyltrrrriemahalslterqikiwfqnrrmklkk
ei

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1b8iB (B:)
arrkrrnfskqaseilneyfyshlsnpypseeakeelarkcgitvsqvsnwfgnkriryk
kni

    Sequence, based on observed residues (ATOM records): (download) 
    >1b8iB (B:)
rrnfskqaseilneyfyshlsnpypseeakeelarkcgitvsqvsnwfgnkrirykkn

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.