PDB entry 1b8f

View 1b8f on RCSB PDB site
Description: histidine ammonia-lyase (hal) from pseudomonas putida
Class: lyase
Keywords: ammonia-lyase, histidine degradation
Deposited on 1999-01-31, released 1999-05-06
The last revision prior to the SCOP 1.73 freeze date was dated 2001-08-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine ammonia-lyase
    Species: Pseudomonas putida
    Gene: HUTH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21310 (1-508)
      • see remark 999 (150)
      • engineered (272)
      • see remark 999 (437)
    Domains in SCOP 1.73: d1b8fa_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8fA (A:)
    teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
    llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
    alialvnaevyphiplkgsvgasgdlaplahmslvllgegkarykgqwlsatealavagl
    epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
    heargqrgqidtaacfrdllgdssevslshknadkvqdpyslrcqpqvmgacltqlrqaa
    evlgieanavsdnplvfaaegdvisggnfhaepvamaadnlalaiaeigslserrislmm
    dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
    paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
    fapdiekavellakgsltgllpagvlpsl