PDB entry 1b8f

View 1b8f on RCSB PDB site
Description: histidine ammonia-lyase (hal) from pseudomonas putida
Deposited on 1999-01-31, released 1999-05-06
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-06, with a file datestamp of 1999-05-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b8fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8fA (A:)
    teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
    llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
    alialvnaevyphiplkgsvgasgdlaplahmslvllgegkarykgqwlsatealavagl
    epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
    heargqrgqidtaacfrdllgdssevslshknadkvqdpyslrcqpqvmgacltqlrqaa
    evlgieanavsdnplvfaaegdvisggnfhaepvamaadnlalaiaeigslserrislmm
    dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
    paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
    fapdiekavellakgsltgllpagvlpsl