PDB entry 1b8f

View 1b8f on RCSB PDB site
Description: Histidine ammonia-lyase (HAL) from Pseudomonas putida
Class: lyase
Keywords: ammonia-lyase, histidine degradation, lyase
Deposited on 1999-01-31, released 1999-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-14, with a file datestamp of 2011-09-09.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine ammonia-lyase
    Species: Pseudomonas putida [TaxId:303]
    Gene: HUTH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21310 (0-508)
      • chromophore (141)
      • engineered mutation (272)
    Domains in SCOPe 2.07: d1b8fa_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8fA (A:)
    teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
    llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
    alialvnaevyphiplkgsvgasgdlaplahmslvllgegkarykgqwlsatealavagl
    epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
    heargqrgqidtaacfrdllgdssevslshknadkvqdpyslrcqpqvmgacltqlrqaa
    evlgieanavsdnplvfaaegdvisggnfhaepvamaadnlalaiaeigslserrislmm
    dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
    paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
    fapdiekavellakgsltgllpagvlpsl