PDB entry 1b8c

View 1b8c on RCSB PDB site
Description: parvalbumin
Class: calcium binding protein
Keywords: calcium binding protein, ef-hand proteins, parvalbumin, calcium-binding
Deposited on 1999-01-29, released 1999-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (parvalbumin)
    Species: Cyprinus carpio [TaxId:7962]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b8ca_
  • Chain 'B':
    Compound: protein (parvalbumin)
    Species: Cyprinus carpio [TaxId:7962]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b8cb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8cA (A:)
    afagvlndadiaaaleackaadsfnhkaffakvgltsksaddvkkafaiiaqdksgfiee
    delklflqnfkadaraltdgetktflkagdsdgdgkigvddwtalvka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8cB (B:)
    afagvlndadiaaaleackaadsfnhkaffakvgltsksaddvkkafaiiaqdksgfiee
    delklflqnfkadaraltdgetktflkagdsdgdgkigvddwtalvka