PDB entry 1b88

View 1b88 on RCSB PDB site
Description: v-alpha 2.6 mouse t cell receptor (tcr) domain
Class: immune system
Keywords: t cell receptor, MHC class I, human immunodeficiency virus, molecular recognition, immune system
Deposited on 1999-02-09, released 1999-02-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t cell receptor v-alpha domain
    Species: Mus musculus [TaxId:10090]
    Gene: TCRAV2S6J38
    Database cross-references and differences (RAF-indexed):
    • GB U63546
    Domains in SCOPe 2.05: d1b88a_
  • Chain 'B':
    Compound: t cell receptor v-alpha domain
    Species: Mus musculus [TaxId:10090]
    Gene: TCRAV2S6J38
    Database cross-references and differences (RAF-indexed):
    • GB U63546 (0-113)
    Domains in SCOPe 2.05: d1b88b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b88A (A:)
    mqqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedg
    rftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b88B (B:)
    mqqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedg
    rftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnp