PDB entry 1b87

View 1b87 on RCSB PDB site
Description: crystal structure of an aminoglycoside 6'-n-acetyltransferase
Class: transferase
Keywords: aminoglycoside 6'-n-acetyltransferase, antibiotic resistance, acetyl coenzyme a, transferase
Deposited on 1999-02-09, released 1999-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.188
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (aminoglycoside n6'-acetyltransferase type 1)
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47764 (0-180)
      • conflict (126)
    Domains in SCOPe 2.07: d1b87a_
  • Heterogens: ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b87A (A:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd
    s