PDB entry 1b85

View 1b85 on RCSB PDB site
Description: lignin peroxidase
Deposited on 1999-02-05, released 1999-02-16
The last revision prior to the SCOP 1.63 freeze date was dated 2001-01-31, with a file datestamp of 2001-01-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.142
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1b85a_
  • Chain 'B':
    Domains in SCOP 1.63: d1b85b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b85A (A:)
    iekratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiaispam
    eaqgkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafagava
    lsncpgapqmnfftgrapatqpapdglvpepfhtvdqiinrvndagefdelelvfmlsah
    svaavndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgeiriq
    sdhtiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqskpip
    gnlpfsffpagktikdveqacaetpfptlttlpgpetsvqrippppga
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b85B (B:)
    ratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiaispameaq
    gkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafagavalsn
    cpgapqmnfftgrapatqpapdglvpepfhtvdqiinrvndagefdelelvfmlsahsva
    avndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgeiriqsdh
    tiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqskpipgnl
    pfsffpagktikdveqacaetpfptlttlpgpetsvqrippppga