PDB entry 1b85

View 1b85 on RCSB PDB site
Description: lignin peroxidase
Class: oxidoreductase
Keywords: LIGNIN DEGRADATION, HEME, RADICAL REACTION, ELECTRON TRANSFER, OXIDOREDUCTASE, Calcium, Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Hydrogen peroxide, Iron, Metal-binding, Peroxidase, Zymogen
Deposited on 1999-02-05, released 1999-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-23, with a file datestamp of 2010-02-19.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.142
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ligninase H8
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Gene: LIP H8, LPOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06181 (Start-350)
      • see remark 999 (120)
      • engineered (177)
    Domains in SCOPe 2.07: d1b85a_
  • Chain 'B':
    Compound: Ligninase H8
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Gene: LIP H8, LPOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06181 (Start-350)
      • see remark 999 (120)
      • engineered (177)
    Domains in SCOPe 2.07: d1b85b_
  • Heterogens: CA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b85A (A:)
    aaviekratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiais
    pameaqgkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafag
    avalsncpgapqmnfftgrapatqpapdglvpepfhtvdqiinrvndagefdelelvfml
    sahsvaavndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgei
    riqsdhtiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqsk
    pipgnlpfsffpagktikdveqacaetpfptlttlpgpetsvqrippppga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b85A (A:)
    iekratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiaispam
    eaqgkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafagava
    lsncpgapqmnfftgrapatqpapdglvpepfhtvdqiinrvndagefdelelvfmlsah
    svaavndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgeiriq
    sdhtiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqskpip
    gnlpfsffpagktikdveqacaetpfptlttlpgpetsvqrippppga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b85B (B:)
    aaviekratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiais
    pameaqgkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafag
    avalsncpgapqmnfftgrapatqpapdglvpepfhtvdqiinrvndagefdelelvfml
    sahsvaavndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgei
    riqsdhtiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqsk
    pipgnlpfsffpagktikdveqacaetpfptlttlpgpetsvqrippppga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b85B (B:)
    ratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiaispameaq
    gkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafagavalsn
    cpgapqmnfftgrapatqpapdglvpepfhtvdqiinrvndagefdelelvfmlsahsva
    avndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgeiriqsdh
    tiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqskpipgnl
    pfsffpagktikdveqacaetpfptlttlpgpetsvqrippppga