PDB entry 1b80

View 1b80 on RCSB PDB site
Description: rec. lignin peroxidase h8 oxidatively processed
Deposited on 1999-02-03, released 1999-02-09
The last revision prior to the SCOP 1.61 freeze date was dated 2001-01-31, with a file datestamp of 2001-01-31.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.17
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1b80a_
  • Chain 'B':
    Domains in SCOP 1.61: d1b80b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b80A (A:)
    viekratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiaispa
    meaqgkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafagav
    alsncpgapqmnfftgrapatqpapdglvpepfhtvdqiinrvndagefdelelvwmlsa
    hsvaavndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgeiri
    qsdhtiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqskpi
    pgnlpfsffpagktikdveqacaetpfptlttlpgpetsvqrippppga
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b80B (B:)
    ratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiaispameaq
    gkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafagavalsn
    cpgapqmnfftgrapatqpapdglvpepfhtvdqiinrvndagefdelelvwmlsahsva
    avndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgeiriqsdh
    tiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqskpipgnl
    pfsffpagktikdveqacaetpfptlttlpgpetsvqrippppga