PDB entry 1b80

View 1b80 on RCSB PDB site
Description: rec. lignin peroxidase h8 oxidatively processed
Class: oxidoreductase
Keywords: lignin degradation, heme, radical reaction, electron transfer, autocatalytic self-oxidation, beta-hydroxy tryptophan, oxidoreductase
Deposited on 1999-02-03, released 1999-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.17
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (recombinant lignin peroxidase h8)
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Gene: LIP H8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06181 (6-350)
      • see remark 999 (120)
    Domains in SCOPe 2.07: d1b80a_
  • Chain 'B':
    Compound: protein (recombinant lignin peroxidase h8)
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Gene: LIP H8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06181 (6-350)
      • see remark 999 (120)
    Domains in SCOPe 2.07: d1b80b_
  • Heterogens: CA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b80A (A:)
    aaviekratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiais
    pameaqgkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafag
    avalsncpgapqmnfftgrapatqpapdglvpepfhtvdqiinrvndagefdelelvwml
    sahsvaavndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgei
    riqsdhtiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqsk
    pipgnlpfsffpagktikdveqacaetpfptlttlpgpetsvqrippppga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b80A (A:)
    viekratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiaispa
    meaqgkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafagav
    alsncpgapqmnfftgrapatqpapdglvpepfhtvdqiinrvndagefdelelvwmlsa
    hsvaavndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgeiri
    qsdhtiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqskpi
    pgnlpfsffpagktikdveqacaetpfptlttlpgpetsvqrippppga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b80B (B:)
    aaviekratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiais
    pameaqgkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafag
    avalsncpgapqmnfftgrapatqpapdglvpepfhtvdqiinrvndagefdelelvwml
    sahsvaavndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgei
    riqsdhtiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqsk
    pipgnlpfsffpagktikdveqacaetpfptlttlpgpetsvqrippppga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b80B (B:)
    ratcsngktvgdasccawfdvlddiqqnlfhggqcgaeahesirlvfhdsiaispameaq
    gkfggggadgsimifddietafhpnigldeivklqkpfvqkhgvtpgdfiafagavalsn
    cpgapqmnfftgrapatqpapdglvpepfhtvdqiinrvndagefdelelvwmlsahsva
    avndvdptvqglpfdstpgifdsqffvetqlrgtafpgsggnqgevesplpgeiriqsdh
    tiardsrtacewqsfvnnqsklvddfqfiflaltqlgqdpnamtdcsdvipqskpipgnl
    pfsffpagktikdveqacaetpfptlttlpgpetsvqrippppga