PDB entry 1b7z

View 1b7z on RCSB PDB site
Description: structure of oxalate substituted diferric mare lactoferrin from colostrum
Class: metal transport
Keywords: lactoferrin, dioxalate, metal binding site, metal transport
Deposited on 1999-01-26, released 1999-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.213
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lactoferrin)
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b7za1, d1b7za2
  • Heterogens: FE, OXL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b7zA (A:)
    aprksvrwctispaeaakcakfqrnmkkvrgpsvscirktssfeciqaiaankadavtld
    gglvyeaglhpyklrpvaaevyqtrgkpqtryyavavvkkgsgfqlnqlqgvkschtglg
    rsagwnipigtlrpylnwtgppeplqkavanffsascvpcadgkqypnlcrlcagteadk
    cacssqepyfgysgafkclengagdvafvkdstvfenlpdeaerdkyellcpdntrkpvd
    afkechlarvpshavvarsvdgredliwkllhraqeefgrnkssafqlfgstpgeqdllf
    kdsalgfvripsqidsglylganyltatqnlretaaevaarrervvwcavgpeeerkckq
    wsdvsnrkvacasastteecialvlkgeadalnldggfiyvagkcglvpvlaenqksqns
    napdcvhrppegylavavvrksdadltwnslsgkkschtgvgrtaawnipmgllfnqtgs
    ckfdkffsqscapgadpqsslcalcvgnnenenkcmpnseeryygytgafrclaekagdv
    afvkdvtvlqntdgknsepwakdlkqedfellcldgtrkpvaeaeschlarapnhavvsq
    sdraqhlkkvlflqqdqfggngpdcpgkfclfksetknllfndnteclaelqgkttyeqy
    lgseyvtsitnlrrcsssplleacaflra