PDB entry 1b7y

View 1b7y on RCSB PDB site
Description: phenylalanyl tRNA synthetase complexed with phenylalaninyl-adenylate
Class: ligase
Keywords: enzyme, tRNA synthetase, alpha/beta homodimer, ligase
Deposited on 1999-01-26, released 2000-01-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (phenylalanyl-tRNA synthetase)
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1b7ya_
  • Chain 'B':
    Compound: protein (phenylalanyl-tRNA synthetase)
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1b7yb1, d1b7yb2, d1b7yb3, d1b7yb4, d1b7yb5, d1b7yb6
  • Heterogens: MG, FYA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b7yA (A:)
    mleealaaiqnardleelkalkarylgkkglltqemkglsalpleerrkrgqelnaikaa
    leaalearekaleeaalkealerervdvslpgaslfsgglhpitlmerelveifralgyq
    avegpeveseffnfdalnipehhpardmwdtfwltgegfrlegplgeevegrlllrthts
    pmqvrymvahtppfrivvpgrvfrfeqtdatheavfhqleglvvgegiamahlkgaiyel
    aqalfgpdskvrfqpvyfpfvepgaqfavwwpeggkwlelggagmvhpkvfqavdayrer
    lglppayrgvtgfafglgverlamlrygipdiryffggrlkfleqfkgvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b7yA (A:)
    vdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhpa
    rdmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfrf
    eqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepga
    qfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlaml
    rygipdiryffggrlkfleqfkgvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b7yB (B:)
    mrvpfswlkayvpelespevleerlaglgfetdriervfpiprgvvfarvleahpipgtr
    lkrlvldagrtvevvsgaenarkgigvalalpgtelpglgqkvgerviqgvrsfgmalsp
    relgvgeygggllefpedalppgtplseawpeevvldlevtpnrpdalgllglardlhal
    gyalvepeaalkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmr
    pinnvvdvtnyvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlvi
    agwrgeesfplglagvmggaesevredteaialevacfdpvsirktarrhglrteashrf
    ergvdplgqvpaqrralsllqalagarvaealleagspkppeaipfrpeyanrllgtsyp
    eaeqiailkrlgcrvegegptyrvtppshrldlrleedlveevariqgyetiplalpaff
    papdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllllnplape
    kaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegvglpwak
    erlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflgalhpeia
    qelelppvhlfelrlplpdkplafqdpsrhpaafrdlavvvpaptpygevealvreaagp
    yleslalfdlyqgpplpeghkslafhlrfrhpkrtlrdeeveeavsrvaealrargfglr
    gldtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b7yB (B:)
    mrvpfswlkayvpelespevleerlaglgfetdriervfpiprgvvfarvleahpipgtr
    lkrlvldagrtvevvsgaenarkgigvalalpgtelpglgqkvgerviqgvrsfgmalsp
    relgvgeygggllefpedalppgtplseawpeevvldlevtpnrpdalgllglardlhal
    gyalvepeaalkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmr
    pinnvvdvtnyvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlvi
    agwrgeesfplglagvmggaesevredteaialevacfdpvsirktarrhglrteashrf
    ergvdplgqvpaqrralsllqalagarvaealleagspkppeaipfrpeyanrllgtsyp
    eaeqiailkrlgcrvegegptyrvtppshrldlrleedlveevariqgyetiplalpaff
    papdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllllnplape
    kaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegvglpwak
    erlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflgalhpeia
    qelelppvhlfelrlplpdkplafqdpsrhpaafrdlavvvpaptpygevealvreaagp
    yleslalfdlyqgpplpeghkslafhlrfrhpkrtlrdeeveeavsrvaealrar